Chicken Shawarma Crispy Rice Salad recipe
1/3
4.8(312 reviews)
RecipeDinnerMedium

Chicken Shawarma Crispy Rice Salad

This colorful salad combines aromatic Middle Eastern spices with crispy rice for a delightful texture contrast. The shawarma-seasoned chicken pairs perfectly with fresh vegetables and a zesty lemon-ta

25

Prep Time

35

Cook Time

60

Total Time

4

Servings

⏱ Cooking Timer

35:00

Minutes : Seconds

minutes

Why You'll Love This Recipe

This colorful salad combines aromatic Middle Eastern spices with crispy rice for a delightful texture contrast. The shawarma-seasoned chicken pairs perfectly with fresh vegetables and a zesty lemon-tahini dressing for a complete meal that's both healthy and satisfying.

Chicken Shawarma Crispy Rice Salad - Step 2

Ingredients

Instructions

1

Step 1

1. In a large bowl, combine chicken with 1 tbsp olive oil, cumin, paprika, garlic powder, turmeric, salt, and pepper. Mix well to coat. Cover and refrigerate for 15 minutes.

2

Step 2

2. Heat a large skillet over medium-high heat. Add remaining 1 tbsp olive oil. Once hot, add chicken and cook for 5-6 minutes per side until golden brown and cooked through (internal temperature 165°F/74°C). Remove from heat and let rest for 5 minutes, then slice into strips.

3

Step 3

3. In the same skillet, add the cooled rice in an even layer. Cook over medium heat for 8-10 minutes without stirring until the bottom becomes golden and crispy. Flip in sections and cook the other side for 3-4 minutes. Remove from heat.

4

Step 4

4. In a small bowl, whisk together tahini, lemon juice, minced garlic, 2 tbsp olive oil, and 2 tbsp water until smooth. Add more water if needed to reach pourable consistency. Season with salt and pepper.

5

Step 5

5. In a large serving bowl, layer crispy rice, sliced chicken, cucumber, tomatoes, red onion, and herbs. Drizzle with tahini dressing just before serving.

Chicken Shawarma Crispy Rice Salad - Step 3

You Must Know

  • For extra crispy rice, spread cooked rice on a baking sheet and refrigerate uncovered for 1-2 hours before cooking
  • Let the chicken rest after cooking to keep it juicy and tender
  • Toast your spices in the skillet for 30 seconds before adding oil for enhanced flavor

Chef's Notes

For extra crispy rice, spread cooked rice on a baking sheet and refrigerate uncovered for 1-2 hours before cooking

Let the chicken rest after cooking to keep it juicy and tender

Toast your spices in the skillet for 30 seconds before adding oil for enhanced flavor

Serving Suggestions

Serve this salad warm or at room temperature for lunch or dinner. It pairs beautifully with warm pita bread, hummus, or a side of pickled vegetables. Perfect for meal prep or casual entertaining.

Nutritional Info (Per Serving)

485

Calories

28g

Protein

38g

Carbs

25g

Fat

Tags

chickenshawarmacrispyricesaladthighsbreaststbsp
Chef Avatar

Lily

Your go-to site for tasty, homemade recipes.

Follow us on social media

More Dinner Recipes

Loading...
Chicken Shawarma Crispy Rice Salad
DINNER

Chicken Shawarma Crispy Rice Salad

This colorful salad combines aromatic Middle Eastern spices with crispy rice for a delightful texture contrast. The shawarma-seasoned chicken pairs perfectly with fresh vegetables and a zesty lemon-ta

Servings:4
Prep:25 min
Cook:35 min

Ingredients (19)

1 lb (450g) boneless, skinless chicken thighs or breasts
2 tbsp (30ml) olive oil
2 tsp ground cumin
1 tsp paprika
1 tsp garlic powder
½ tsp ground turmeric
½ tsp salt
¼ tsp black pepper
2 cups (400g) cooked basmati rice, cooled and refrigerated for at least 2 hours
1 cucumber, diced (about 1½ cups)
2 medium tomatoes, chopped (about 1½ cups)
½ red onion, thinly sliced
½ cup (15g) fresh parsley or cilantro, chopped
¼ cup (60ml) tahini
Juice of 1 lemon (about 3 tbsp)
1 garlic clove, minced
2 tbsp (30ml) olive oil
2-3 tbsp water (to thin dressing)
Salt and pepper to taste

Instructions

  1. In a large bowl, combine chicken with 1 tbsp olive oil, cumin, paprika, garlic powder, turmeric, salt, and pepper. Mix well to coat. Cover and refrigerate for 15 minutes.
  2. Heat a large skillet over medium-high heat. Add remaining 1 tbsp olive oil. Once hot, add chicken and cook for 5-6 minutes per side until golden brown and cooked through (internal temperature 165°F/74°C). Remove from heat and let rest for 5 minutes, then slice into strips.
  3. In the same skillet, add the cooled rice in an even layer. Cook over medium heat for 8-10 minutes without stirring until the bottom becomes golden and crispy. Flip in sections and cook the other side for 3-4 minutes. Remove from heat.
  4. In a small bowl, whisk together tahini, lemon juice, minced garlic, 2 tbsp olive oil, and 2 tbsp water until smooth. Add more water if needed to reach pourable consistency. Season with salt and pepper.
  5. In a large serving bowl, layer crispy rice, sliced chicken, cucumber, tomatoes, red onion, and herbs. Drizzle with tahini dressing just before serving.

More Dinner Recipes

Loading...

Community Reviews

What cooks are saying

4.8

312 reviews

Loading reviews…

Share your experience

Leave a review

Help other home cooks decide if this recipe is right for them. Honest feedback is appreciated!